General Information

  • ID:  hor005966
  • Uniprot ID:  P22923
  • Protein name:  Lipotropin gamma
  • Gene name:  pomc
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKD
  • Length:  46
  • Propeptide:  MLQPVWSCILALLGVFIFHVGEVRSQCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHMQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNGGYKREDIANYPILNLLTGSDNQNTQQGIMEDEAVDRQDSKRSYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLELRRELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
  • Signal peptide:  MLQPVWSCILALLGVFIFHVGEVRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P22923-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005966_AF2.pdbhor005966_ESM.pdb

Physical Information

Mass: 629581 Formula: C243H361N63O81S
Absent amino acids: ACIQ Common amino acids: D
pI: 4.27 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -152.39 Boman Index: -15172
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.7
Instability Index: 5644.57 Extinction Coefficient cystines: 8480
Absorbance 280nm: 188.44

Literature

  • PubMed ID:  2260977
  • Title:  Characterization of the cDNA encoding proopiomelanocortin in the frog Rana ridibunda.